Validation Data Gallery
Tested Applications
| Positive WB detected in | MCF-7 cells, mouse brain tissue, MDA-MB-231 cells |
| Positive IP detected in | MCF-7 cells |
| Positive IHC detected in | rat brain tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | PC-12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 8 publications below |
| WB | See 15 publications below |
| IHC | See 2 publications below |
| IF | See 4 publications below |
| IP | See 3 publications below |
Product Information
12651-1-AP targets SIAH2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3342 Product name: Recombinant human SIAH2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-324 aa of BC013082 Sequence: MSRPSSTGPSANKPCSKQPPPQPQHTPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGGGGGAGPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCP 相同性解析による交差性が予測される生物種 |
| Full Name | seven in absentia homolog 2 (Drosophila) |
| Calculated molecular weight | 324 aa, 35 kDa |
| Observed molecular weight | 35-40 kDa |
| GenBank accession number | BC013082 |
| Gene Symbol | SIAH2 |
| Gene ID (NCBI) | 6478 |
| RRID | AB_2877868 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43255 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
The mammalian Seven-in-absentia homolog 2 (SIAH2), is a RING finger type ubiquitin ligase with a catalytic RING domain on its N-terminus, followed by two zinc fingers and a C-terminal substrate binding domain. Siah is a mammalian homolog of Sina, a Drosophila protein functioning in eye development. Mammals express two isoforms, Siah1 and 2, and mice exhibit two Siah1 isotypes, 1a and 1b. SIAH2 indirectly regulates the level of HIF-1α by promoting degradation of PHDs by UPS. SIAH2, in turn, is positively regulated by hypoxia-dependent transcriptional and posttranscriptional mechanisms.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SIAH2 antibody 12651-1-AP | Download protocol |
| IHC protocol for SIAH2 antibody 12651-1-AP | Download protocol |
| IP protocol for SIAH2 antibody 12651-1-AP | Download protocol |
| WB protocol for SIAH2 antibody 12651-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Cell Biol Heat stress activates YAP/TAZ to induce the heat shock transcriptome.
| ||
J Exp Clin Cancer Res PHB2 promotes SHIP2 ubiquitination via the E3 ligase NEDD4 to regulate AKT signaling in gastric cancer | ||
Int J Biol Sci Cold atmospheric plasma potentiates ferroptosis via EGFR(Y1068)-mediated dual axes on GPX4 among triple negative breast cancer cells | ||
Cell Death Dis PIWIL2 suppresses Siah2-mediated degradation of HDAC3 and facilitates CK2α-mediated HDAC3 phosphorylation. | ||
Int Immunopharmacol Methylene blue targets PHD3 expression in murine microglia to mitigate lipopolysaccharide-induced neuroinflammation and neurocognitive impairments |





