Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, K-562 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 6 publications below |
| WB | See 17 publications below |
| IHC | See 4 publications below |
| IF | See 7 publications below |
| IP | See 4 publications below |
| CoIP | See 1 publications below |
Product Information
14112-1-AP targets RNF8 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5292 Product name: Recombinant human RNF8 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 130-485 aa of BC007517 Sequence: ETIYPCLSPKNDQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKINKVSCESGQPVKSQGKGEVASTPSDNLDPKLTALEPSKTTGAPIYPGFPKVTEVHHEQKASNSSASQRSLQMFKVTMSRILRLKIQMQEKHEAVMNVKKQTQKGNSKKVVQMEQELQDLQSQLCAEQAQQQARVEQLEKTFQEEEQHLQGLEIAQGEKDLKQQLAQALQEHWALMEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERKAKRLF 相同性解析による交差性が予測される生物種 |
| Full Name | ring finger protein 8 |
| Calculated molecular weight | 485 aa, 56 kDa |
| Observed molecular weight | 56-60 kDa |
| GenBank accession number | BC007517 |
| Gene Symbol | RNF8 |
| Gene ID (NCBI) | 9025 |
| RRID | AB_2878016 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O76064 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
RNF8, also named as KIAA0646 or E3 ubiquitin-protein ligase RNF8, is a 485 amino acid protein, which contains one RING-type zinc finger and one FHA domain. RNF8 localizes in the nucleus and belongs to the RNF8 family. E2-E3 ubiquitin ligase complex is composed of the RNF8 homodimer and a E2 heterodimer of UBE2N and UBE2V2. E3 ubiquitin-protein ligase that plays a key role in DNA damage signaling via 2 distinct roles: by mediating the 'Lys-63'-linked ubiquitination of histones H2A and H2AX and promoting the recruitment of DNA repair proteins at double-strand breaks (DSBs) sites, and by catalyzing 'Lys-48'-linked ubiquitination to remove target proteins from DNA damage sites.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RNF8 antibody 14112-1-AP | Download protocol |
| IHC protocol for RNF8 antibody 14112-1-AP | Download protocol |
| IP protocol for RNF8 antibody 14112-1-AP | Download protocol |
| WB protocol for RNF8 antibody 14112-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Ubiquitination-Deficient Mutations in Human Piwi Cause Male Infertility by Impairing Histone-to-Protamine Exchange during Spermiogenesis. | ||
Cell Death Differ CAMK2D serves as a molecular scaffold for RNF8-MAD2 complex to induce mitotic checkpoint in glioma | ||
Nat Commun Non-canonical function of DGCR8 in DNA double-strand break repair signaling and tumor radioresistance. | ||
EMBO J The p97-Ataxin 3 complex regulates homeostasis of the DNA damage response E3 ubiquitin ligase RNF8.
| ||
Nucleic Acids Res GLP-catalyzed H4K16me1 promotes 53BP1 recruitment to permit DNA damage repair and cell survival. | ||






