Recombinant human PTGER4 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag19217
Synonyms
EP4; EP4R; MGC126583
Validation Data Gallery View All
Product Information
| Peptide Sequence |
RKTVLSKAIEKIKCLFCRIGGSRRERSGQHCSDSQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPGMGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSETLNLSEKCI
(333-488 aa encoded by BC101534) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |





