Validation Data Gallery
Tested Applications
| Positive WB detected in | HepG2 cells, HeLa cells, Jurkat cells, mouse embryo tissue, Raji cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue | 
| Positive IP detected in | mouse brain tissue | 
| Positive IHC detected in | human breast cancer tissue, human lymphoma tissue,  human lung tissue,  human colon cancer tissue,  human lung cancer tissue,  mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 | 
| Positive IF/ICC detected in | HepG2 cells, HeLa cells | 
| Positive FC (Intra) detected in | HeLa cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 | 
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 9 publications below | 
| WB | See 22 publications below | 
| IHC | See 4 publications below | 
| IF | See 3 publications below | 
| IP | See 7 publications below | 
| CoIP | See 1 publications below | 
Product Information
18436-1-AP targets PRMT5 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse | 
| Cited Reactivity | human, mouse | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | CatNo: Ag9736 Product name: Recombinant human PRMT5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 283-637 aa of BC025979 Sequence: YLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL相同性解析による交差性が予測される生物種 | 
| Full Name | protein arginine methyltransferase 5 | 
| Calculated molecular weight | 637 aa, 73 kDa | 
| Observed molecular weight | 68-70 kDa | 
| GenBank accession number | BC025979 | 
| Gene Symbol | PRMT5 | 
| Gene ID (NCBI) | 10419 | 
| RRID | AB_2171798 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | O14744 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
PRMT5 is a Type II enzyme that catalyzes arginine monomethylation and symmetric dimethylation (Rme1 and Rme2s). The many targets of PRMT5 include ribosomal proteins, the histone chaperone nucleoplasmin, p53, and histones. PRMT5 is frequently observed in a complex with the cofactor, methylosome protein 50 (MEP50), which is required for PRMT5 activity. PRMT5 is upregulated in several human malignancies, including lymphomas, lung cancer, breast cancer and colorectal cancer.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PRMT5 antibody 18436-1-AP | Download protocol | 
| IHC protocol for PRMT5 antibody 18436-1-AP | Download protocol | 
| IP protocol for PRMT5 antibody 18436-1-AP | Download protocol | 
| WB protocol for PRMT5 antibody 18436-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
| Adv Sci (Weinh) TBL2 Promotes Tumorigenesis via PRMT5/WDR77-Mediated AKT Activation in Breast Cancer | ||
| Sci Adv Arginine methyltransferase PRMT5 negatively regulates cGAS-mediated antiviral immune response.
 | ||
| Nat Commun The LINC01138 drives malignancies via activating arginine methyltransferase 5 in hepatocellular carcinoma. | ||
| Nat Commun PRMT5-mediated arginine methylation activates AKT kinase to govern tumorigenesis. | ||
| EMBO J MST2 methylation by PRMT5 inhibits Hippo signaling and promotes pancreatic cancer progression
 | ||























