Validation Data Gallery
Tested Applications
| Positive WB detected in | K-562 cells, mouse thymus tissue, human peripheral blood platelets, mouse brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | K-562 cells |
| Positive IF detected in | zebrafish retina |
| Positive FC (Intra) detected in | K-562 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Immunofluorescence (IF) | IF : 1:150-1:600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 24 publications below |
| IHC | See 3 publications below |
| IF | See 2 publications below |
| CoIP | See 1 publications below |
Product Information
12919-1-AP targets pan-PKC in WB, IHC, IF, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples.
| Tested Reactivity | human, mouse, rat, zebrafish |
| Cited Reactivity | human, mouse, rat, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3591 Product name: Recombinant human PRKCB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 342-598 aa of BC036472 Sequence: FNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHA 相同性解析による交差性が予測される生物種 |
| Full Name | protein kinase C, beta |
| Calculated molecular weight | 673 aa, 77 kDa |
| Observed molecular weight | 77 kDa |
| GenBank accession number | BC036472 |
| Gene Symbol | PRKCB |
| Gene ID (NCBI) | 5579 |
| RRID | AB_2237469 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P05771 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. Protein kinase Cs (PKCs) are signaling molecules that play key roles in many cellular processes, including secretion, gene expression, proliferation, and muscle contraction. The PKC family is broadly divided into three subgroups: classical, novel, and atypical PKCs. These subgroups differ in both protein sequences and mechanistic requirements for catalytic activity. PKC beta is one of the PKC family members. PKC beta has been reported to be involved in many different cellular functions, such as B cell activation, apoptosis induction, endothelial cell proliferation, and intestinal sugar absorption. Studies in mice also suggest that this kinase may also regulate neuronal functions and correlate fear-induced conflict behavior after stress. This antibody can recognize PKC beta, PKC alpha, PKC gamma, PKC epsilon and PKC delta.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for pan-PKC antibody 12919-1-AP | Download protocol |
| IHC protocol for pan-PKC antibody 12919-1-AP | Download protocol |
| IP protocol for pan-PKC antibody 12919-1-AP | Download protocol |
| WB protocol for pan-PKC antibody 12919-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Rep Med A genome-wide association study identified PRKCB as a causal gene and therapeutic target for Mycobacterium avium complex disease | ||
J Hematol Oncol Integrated proteogenomic characterization of urothelial carcinoma of the bladder. | ||
Am J Respir Cell Mol Biol Intermittent Hypoxia Augments Pulmonary Vasoconstrictor Reactivity through PKCβ/Mitochondrial Oxidant Signaling.
| ||
J Cell Mol Med Brucine suppresses colon cancer cells growth via mediating KDR signalling pathway. | ||
Oxid Med Cell Longev p66Shc Mediates Mitochondrial Dysfunction Dependent on PKC Activation in Airway Epithelial Cells Induced by Cigarette Smoke. | ||
J Cell Mol Med Prostaglandin E3 attenuates macrophage-associated inflammation and prostate tumour growth by modulating polarization. |








