Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse brain tissue, HeLa cells, human stomach tissue, K-562 cells, rat brain tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse testis tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 6 publications below |
| IF | See 1 publications below |
Product Information
13210-1-AP targets PPP3R1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3992 Product name: Recombinant human PPP3R1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-170 aa of BC027913 Sequence: MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV 相同性解析による交差性が予測される生物種 |
| Full Name | protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform |
| Calculated molecular weight | 170 aa, 19 kDa |
| Observed molecular weight | 19 kDa |
| GenBank accession number | BC027913 |
| Gene Symbol | PPP3R1 |
| Gene ID (NCBI) | 5534 |
| RRID | AB_2252760 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P63098 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Protein phosphatase 3 (PPP3, formerly PP2B, Calcineurin), a serine/ threonine protein phosphatase, is a heterodimer composed of one catalytic subunit (PPP3C, Calcineurin A) and one regulatory subunit (PPP3R, Calcineurin B). PPP3R has two isoforms, PPP3R1 and PPP3R2. PPP3Rl is ubiquitously expressed in different tissues and is coded by the PPP3R1 gene which was mapped recently to human chromosome 2. PPP3Rl has four functional calcium-binding sites.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PPP3R1 antibody 13210-1-AP | Download protocol |
| IHC protocol for PPP3R1 antibody 13210-1-AP | Download protocol |
| IP protocol for PPP3R1 antibody 13210-1-AP | Download protocol |
| WB protocol for PPP3R1 antibody 13210-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Autophagy SMURF1 controls the PPP3/calcineurin complex and TFEB at a regulatory node for lysosomal biogenesis | ||
Acta Biomater Substrate stiffness regulates differentiation of induced pluripotent stem cells into heart valve endothelial cells. | ||
Proc Natl Acad Sci U S A Major contribution of the 3/6/7 class of TRPC channels to myocardial ischemia/reperfusion and cellular hypoxia/reoxygenation injuries. | ||
Biochem Biophys Res Commun The calcineurin B subunit induces TNF-related apoptosis-inducing ligand (TRAIL) expression via CD11b-NF-κB pathway in RAW264.7 macrophages. | ||
Biol Trace Elem Res Transcriptional Study Revealed That Boron Supplementation May Alter the Immune-Related Genes Through MAPK Signaling in Ostrich Chick Thymus. | ||
Autophagy Narirutin activates TFEB (transcription factor EB) to protect against acetaminophen-induced liver injury by targeting PPP3/calcineurin |









