Validation Data Gallery
Tested Applications
| Positive WB detected in | human lung tissue |
| Positive IP detected in | HL-60 cells |
| Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 9 publications below |
| IHC | See 3 publications below |
| IF | See 3 publications below |
| IP | See 1 publications below |
| ChIP | See 4 publications below |
| RIP | See 1 publications below |
Product Information
12571-1-AP targets PBX3 in WB, IHC, IF/ICC, IP, chIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3239 Product name: Recombinant human PBX3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 19-367 aa of BC016977 Sequence: QLMRLDNMLLAEGVSGPEKGGGSAAAAAAAAASGGSSDNSIEHSDYRAKLTQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQSLVKDPKERGSKGSDIQPTSVVSNWFGNKRIRYKKNIGKFQEEANLYAAKTAVTAAHAVAAAVQNNQTNSPTTPNSGSSGSFNLPNSGDMFMNMQSLNGDSYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGGNSLYSPHNLNANGGWQDATTPSSVTSPTEGPGSVHSDTSN 相同性解析による交差性が予測される生物種 |
| Full Name | pre-B-cell leukemia homeobox 3 |
| Calculated molecular weight | 434 aa, 47 kDa |
| Observed molecular weight | 47-50 kDa |
| GenBank accession number | BC016977 |
| Gene Symbol | PBX3 |
| Gene ID (NCBI) | 5090 |
| RRID | AB_2160469 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P40426 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
PBX3 is a homeodomain-containing transcription factor of the pre-B cell leukemia (PBX) family, members of which have extensive roles in early development and some adult processes. It plays crucial roles in embryonic development, organogenesis, and cell differentiation by regulating the expression of downstream target genes. Beyond its physiological functions, PBX3 is increasingly recognized for its significant involvement in oncogenesis. It is frequently overexpressed in various malignancies, including leukemias and solid tumors, where it promotes cell proliferation, inhibits apoptosis, enhances invasion and metastasis, and contributes to chemotherapy resistance.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PBX3 antibody 12571-1-AP | Download protocol |
| IHC protocol for PBX3 antibody 12571-1-AP | Download protocol |
| IP protocol for PBX3 antibody 12571-1-AP | Download protocol |
| WB protocol for PBX3 antibody 12571-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cancer Circular RNA circCORO1C promotes laryngeal squamous cell carcinoma progression by modulating the let-7c-5p/PBX3 axis. | ||
Haematologica P2X7 promotes the progression of MLL-AF9 induced acute myeloid leukemia by upregulation of Pbx3.
| ||
Cell Mol Gastroenterol Hepatol scRNA-Seq Reveals New Enteric Nervous System Roles for GDNF, NRTN, and TBX3. | ||
Free Radic Biol Med Systematical exploration of transcription factors in cardiomyocytes against hydrogen peroxide-induced oxidative stress by Danhong injection. | ||
Int J Biol Sci USF1-ATRAP-PBX3 Axis Promote Breast Cancer Glycolysis and Malignant Phenotype by Activating AKT/mTOR Signaling. | ||
Sci Rep Screening and identification of critical transcription factors involved in the protection of cardiomyocytes against hydrogen peroxide-induced damage by Yixin-shu. |



