Validation Data Gallery
Tested Applications
| Positive WB detected in | BxPC-3 cells, HeLa cells, HEK-293 cells, JAR cells, mouse kidney tissue, mouse lung tissue, U-118 MG cells, U-251 cells, U-87 MG cells |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A549 cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 15 publications below |
| WB | See 307 publications below |
| IHC | See 54 publications below |
| IF | See 37 publications below |
| IP | See 2 publications below |
| CoIP | See 3 publications below |
Product Information
14347-1-AP targets NOX4 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, rabbit, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5687 Product name: Recombinant human NOX4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 224-578 aa of BC040105 Sequence: PGCISLNRTSSQNISLPEYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANFPQTWLWISGPLCLYCAERLYRYIRSNKPVTIISVISHPSDVMEIRMVKENFKARPGQYITLHCPSVSALENHPFTLTMCPTETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYEVSLCVAGGIGVTPFASILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLLCMLHNKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS 相同性解析による交差性が予測される生物種 |
| Full Name | NADPH oxidase 4 |
| Calculated molecular weight | 67 kDa |
| Observed molecular weight | 58-67 kDa |
| GenBank accession number | BC040105 |
| Gene Symbol | NOX4 |
| Gene ID (NCBI) | 50507 |
| RRID | AB_10638146 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NPH5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
NOX4 (NADPH oxidase 4) is a phagocyte-type oxidase, similar to that responsible for the production of large amounts of reactive oxygen species (ROS) in neutrophil granulocytes with resultant antimicrobial activity and it has been postulated to function in the kidney as an oxygen sensor that regulates the synthesis of erythropoietin in the renal cortex. Studies have reported molecular masses of Nox4 protein by western blot analysis ranging from 55 to 80 kDa. The truncated NOX4 splice variant D (28 kDa) lacks the majority of the transmembrane domain and has been shown to produce higher levels of ROS and DNA damage compared to its prototype. NOX4D has previously been shown to localise to the nucleus and nucleolus in various cell types and is implicated in the generation of reactive oxygen species (ROS) and DNA damage. (PMID: 11728818, PMID: 29285262, PMID: 14670934)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NOX4 antibody 14347-1-AP | Download protocol |
| IHC protocol for NOX4 antibody 14347-1-AP | Download protocol |
| WB protocol for NOX4 antibody 14347-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Circulation Megakaryocytic Leukemia 1 (MKL1) Bridges Epigenetic Activation of NADPH Oxidase in Macrophages to Cardiac Ischemia-Reperfusion Injury. | ||
Nat Commun Spatial oxidation of L-plastin downmodulates actin-based functions of tumor cells. | ||
Aging Cell Lysyl oxidase-like 2 inhibitor rescues D-galactose-induced skeletal muscle fibrosis. | ||
Adv Healthc Mater Copper-Based Composites Nanoparticles Improve Triple-Negative Breast Cancer Treatment with Induction of Apoptosis-Cuproptosis and Immune Activation | ||
Redox Biol Silencing COX-2 blocks PDK1/TRAF4-induced AKT activation to inhibit fibrogenesis during skeletal muscle atrophy. | ||
Redox Biol RND3 attenuates oxidative stress and vascular remodeling in spontaneously hypertensive rat via inhibiting ROCK1 signaling. |







