Validation Data Gallery
Tested Applications
| Positive WB detected in | L02 cells, HepG2 cells, mouse liver tissue, rat liver tissue | 
| Positive IP detected in | HepG2 cells | 
| Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 | 
| Positive IF/ICC detected in | HepG2 cells | 
| Positive FC (Intra) detected in | HepG2 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 | 
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 7 publications below | 
| WB | See 22 publications below | 
| IHC | See 8 publications below | 
| IF | See 2 publications below | 
| IP | See 1 publications below | 
Product Information
15123-1-AP targets NNMT in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse, rat | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | CatNo: Ag7197 Product name: Recombinant human NNMT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-264 aa of BC000234 Sequence: MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL相同性解析による交差性が予測される生物種 | 
| Full Name | nicotinamide N-methyltransferase | 
| Calculated molecular weight | 30 kDa | 
| Observed molecular weight | 30 kDa | 
| GenBank accession number | BC000234 | 
| Gene Symbol | NNMT | 
| Gene ID (NCBI) | 4837 | 
| RRID | AB_2153579 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | P40261 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
NNMT can catalyze the N-methylation of nicotinamide using the universal methyl donor S-adenosyl-L-methionine to form N1-methylnicotinamide and S-adenosyl-L-homocysteine, a predominant nicotinamide/vitamin B3 clearance pathway (PMID: 21823666; 23455543; 8182091). It plays a central role in regulating cellular methylation potential, by consuming S-adenosyl-L-methionine and limiting its availability for other methyltransferases. Actively mediates genome-wide epigenetic and transcriptional changes through hypomethylation of repressive chromatin marks, such as H3K27me3 (PMID: 23455543; PMID: 26571212; PMID: 31043742).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NNMT antibody 15123-1-AP | Download protocol | 
| IHC protocol for NNMT antibody 15123-1-AP | Download protocol | 
| IP protocol for NNMT antibody 15123-1-AP | Download protocol | 
| WB protocol for NNMT antibody 15123-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
| Cell Rep Single-cell analysis reveals insights into epithelial abnormalities in ovarian endometriosis | ||
| Oncogene Stromal nicotinamide N-methyltransferase orchestrates the crosstalk between fibroblasts and tumour cells in oral squamous cell carcinoma: evidence from patient-derived assembled organoids | ||
| Mol Metab Disrupted Liver Oxidative Metabolism in Glycine N-Methyltransferase-Deficient Mice is Mitigated by Dietary Methionine Restriction. | ||
| Mol Oncol Elevated N-methyltransferase expression induced by hepatic stellate cells contributes to the metastasis of hepatocellular carcinoma via regulation of the CD44v3 isoform.
 | ||
| Front Cell Infect Microbiol Persistent Exposure to Porphyromonas gingivalis Promotes Proliferative and Invasion Capabilities, and Tumorigenic Properties of Human Immortalized Oral Epithelial Cells. | ||
| Sci Rep The significance of NAD + metabolites and nicotinamide N-methyltransferase in chronic kidney disease. | 






