Validation Data Gallery
Tested Applications
| Positive WB detected in | A549 cells, HeLa cells, Calu-1 cells, HEK-293 cells, NIH/3T3 cells | 
| Positive IP detected in | HEK-293 cells, mouse testis tissue | 
| Positive IHC detected in | human ovary cancer tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 | 
| Positive IF/ICC detected in | NIH/3T3 cells, HeLa cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:20000-1:100000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13365-1-AP targets NAT10 in WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse | 
| Cited Reactivity | human, mouse, rat, canine, zebrafish | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | CatNo: Ag4184 Product name: Recombinant human NAT10 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 676-1025 aa of BC035558 Sequence: EAVSLLEEVITPRKDLPPLLLKLNERPAERLDYLGVSYGLTPRLLKFWKRAGFVPVYLRQTPNDLTGEHSCIMLKTLTDEDEADQGGWLAAFWKDFRRRFLALLSYQFSTFSPSLALNIIQNRNMGKPAQPALSREELEALFLPYDLKRLEMYSRNMVDYHLIMDMIPAISRIYFLNQLGDLALSAAQSALLLGIGLQHKSVDQLEKEIELPSGQLMGLFNRIIRKVVKLFNEVQEKAIEEQMVAAKDVVMEPTMKTLSDDLDEAAKEFQEKHKKEVGKLKSMDLSEYIIRGDDEEWNEVLNKAGPNASIISLKSDKKRKLEAKQEPKQSKKLKNRETKNKKDMKLKRKK相同性解析による交差性が予測される生物種 | 
| Full Name | N-acetyltransferase 10 (GCN5-related) | 
| Calculated molecular weight | 1025 aa, 116 kDa | 
| Observed molecular weight | 116 kDa | 
| GenBank accession number | BC035558 | 
| Gene Symbol | NAT10 | 
| Gene ID (NCBI) | 55226 | 
| RRID | AB_2148944 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q9H0A0 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
NAT10 (N-acetyltransferase 10) is a nucleolar protein that is involved in regulation of telomerase activity, DNA damage response, and cytokinesis. It also plays a role in maintaining nuclear shape. Inhibition of NAT10 has been reported to rescue the misshapen nuclei in laminopathic cells via microtubule reorganization. NAT10 is the first enzyme to be found to catalyze ac4C production in eukaryotic RNA and has acetyltransferase activity and RNA-binding activity. (PMID: 23592795). NAT10 is the singular human enzyme to have both acetyltransferase and RNA binding activities (PMID: 30449621). NAT10 is associated with U3 small nucleolar RNA and acetylates upstream binding factors to activate rRNA transcription (PMID: 21177859). NAT10 promoted cisplatin chemoresistance in bladder cancer cells by enhancing DNA damage repair (DDR) (PMID: 36939377). NAT10 is a vital member of the Gcn5-related N-acetyltransferase (GNAT) family and contains 1,025 amino acids with a molecular weight of 116 kDa (PMID: 37128278). NAT10 is commonly expressed in lymphoid tissue, kidney, liver, cerebellum, cerebral cortex, and the central nervous system during the embryonic period. Normal tissue cells express NAT10 in the nucleus, while tumor cells translocate NAT10 to the cytoplasm, nucleoplasm, and nuclear membrane, affecting tumor formation (PMID: 37128278). The specificity of this antibody has been tested by siRNA. (24786082)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NAT10 antibody 13365-1-AP | Download protocol | 
| IHC protocol for NAT10 antibody 13365-1-AP | Download protocol | 
| IP protocol for NAT10 antibody 13365-1-AP | Download protocol | 
| WB protocol for NAT10 antibody 13365-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
| Nat Commun N-acetyltransferase 10 is implicated in the pathogenesis of cycling T cell-mediated autoimmune and inflammatory disorders in mice | ||
| Cell Host Microbe Acetylation of Cytidine Residues Boosts HIV-1 Gene Expression by Increasing Viral RNA Stability.
 | ||
| Mol Cell Direct epitranscriptomic regulation of mammalian translation initiation through N4-acetylcytidine. | ||
| Nucleic Acids Res N4-acetylcytidine coordinates with NP1 and CPSF5 to facilitate alternative RNA processing during the replication of minute virus of canines
 | 











