Validation Data Gallery
Tested Applications
| Positive WB detected in | rat liver tissue, HL-60 cells, MCF-7 cells, mouse heart tissue, mouse liver tissue, mouse skeletal muscle tissue, Ramos cells, RAW 264.7 cells |
| Positive IP detected in | mouse heart tissue |
| Positive IHC detected in | human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells, HeLa cells, U-87 MG cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 10 publications below |
| WB | See 76 publications below |
| IHC | See 20 publications below |
| IF | See 11 publications below |
| IP | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
11776-1-AP targets NAMPT/PBEF in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples.
| Tested Reactivity | human, mouse, rat, zebrafish |
| Cited Reactivity | human, mouse, rat, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2434 Product name: Recombinant human NAMPT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC020691 Sequence: MNPAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQYILNKYLKGKVVTKEKIQEAKDVYKEHFQDDVFNEKGWNYILEKYDGHLPIEIKAVPEGFVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIVSRSTQAPLIIRPDSGNPLDTVLKVLEILGKKFPVTENSKGYKLLPPYLRV 相同性解析による交差性が予測される生物種 |
| Full Name | nicotinamide phosphoribosyltransferase |
| Calculated molecular weight | 52 kDa |
| Observed molecular weight | 50-55 kDa |
| GenBank accession number | BC020691 |
| Gene Symbol | NAMPT/PBEF |
| Gene ID (NCBI) | 10135 |
| RRID | AB_2298317 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P43490 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Nicotinamide phosphoribosyltransferase(NAMPT) has two usual synonyms termed Visfatin and PBEF. Its primary role is to catalyze the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, an intermediate in the biosynthesis of NAD, which is the rate limiting component in the mammalian NAD biosynthesis pathway. NAMPT is expressed in large amounts in bone marrow, liver tissue, and muscle tissues. NAMPT inhibits neutrophil apoptosis in experimental inflammation and clinical sepsis. NAMPT levels are altered in plasma of patients with type 2 diabetes mellitus (T2DM), and it is now evidenced that NAMPT may plays a role in lipid metabolism.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NAMPT/PBEF antibody 11776-1-AP | Download protocol |
| IHC protocol for NAMPT/PBEF antibody 11776-1-AP | Download protocol |
| IP protocol for NAMPT/PBEF antibody 11776-1-AP | Download protocol |
| WB protocol for NAMPT/PBEF antibody 11776-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cancer Cell Inhibition of De Novo NAD(+) Synthesis by Oncogenic URI Causes Liver Tumorigenesis through DNA Damage. | ||
Cell Metab NAD+ Metabolism Maintains Inducible PD-L1 Expression to Drive Tumor Immune Evasion.
| ||
Acta Pharm Sin B Thermal proteome profiling (TPP) reveals NAMPT as the anti-glioma target of phenanthroindolizidine alkaloid PF403 | ||
Cell Death Dis Astrocyte-derived exosomal nicotinamide phosphoribosyltransferase (Nampt) ameliorates ischemic stroke injury by targeting AMPK/mTOR signaling to induce autophagy | ||
Free Radic Biol Med Tetramethylpyrazine: A Fermented Alcohol Product that Mitigates Alcoholic Liver Disease in Mice | ||
Antioxidants (Basel) Hyperosmolarity-Induced Oxidative Stress Leads to Senescence in Human Corneal Epithelial Cells (HCEPC) via DNA Damage, Metabolic Disturbance and Mitophagy Decline. |
















