Validation Data Gallery
Tested Applications
| Positive WB detected in | Jurkat cells, rat spleen tissue, mouse liver tissue, mouse spleen tissue |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 23 publications below |
Product Information
10984-1-AP targets MRPS22 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1421 Product name: Recombinant human MRPS22 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-360 aa of BC009296 Sequence: MAPLGTTVLLWSLLRSSPGVERVCFRARIQPWHGGLLQPLPCSFEMGLPRRRFSSEAAESGSPETKKPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQGAKDQAAEGINLIKVFAKTEAQKGAYIELTLQTYQEALSRHSAAS 相同性解析による交差性が予測される生物種 |
| Full Name | mitochondrial ribosomal protein S22 |
| Calculated molecular weight | 41 kDa |
| Observed molecular weight | 38 kDa |
| GenBank accession number | BC009296 |
| Gene Symbol | MRPS22 |
| Gene ID (NCBI) | 56945 |
| RRID | AB_2146488 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P82650 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
MRPS22, also named as C3orf5, RPMS22 and S22mt, is a component of the mitochondrial ribosome small subunit (28S) which comprises a 12S rRNA and about 30 distinct proteins. Defects in MRPS22 are the cause of combined oxidative phosphorylation deficiency type 5 (COXPD5). MRPS22 is a 360-amino-acid protein that has been found in a limited number of species, having no ortholog in fungi or prokaryotes. The exact location of MRPS22 in the three dimensional structure of the ribosome and its exact function are currently unknown. Recently, a MRPS22 defect was shown to strongly hamper assembly of the small ribosomal subunit, whereas assembly of the large subunit and part of the small subunit were only mildly affected.(PMID:21189481)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MRPS22 antibody 10984-1-AP | Download protocol |
| IP protocol for MRPS22 antibody 10984-1-AP | Download protocol |
| WB protocol for MRPS22 antibody 10984-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Metab The mitochondrial RNA-binding protein GRSF1 localizes to RNA granules and is required for posttranscriptional mitochondrial gene expression. | ||
Cell Rep The Human Mitochondrial DEAD-Box Protein DDX28 Resides in RNA Granules and Functions in Mitoribosome Assembly. | ||
PLoS Genet Mutations in the UQCC1-Interacting Protein, UQCC2, Cause Human Complex III Deficiency Associated with Perturbed Cytochrome b Protein Expression. | ||
Nucleic Acids Res Replication factors transiently associate with mtDNA at the mitochondrial inner membrane to facilitate replication. | ||
Nucleic Acids Res C7orf30 specifically associates with the large subunit of the mitochondrial ribosome and is involved in translation. | ||
Nucleic Acids Res p32/gC1qR is indispensable for fetal development and mitochondrial translation: importance of its RNA-binding ability. |





