Validation Data Gallery
Tested Applications
| Positive WB detected in | HT-1080 cells, MCF-7 cells, U-87 MG cells, HepG2 cells, U-251 cells, J774A.1 cells |
| Positive IP detected in | MCF-7 cells |
| Positive IHC detected in | human gliomas tissue, human placenta tissue, human prostate cancer tissue, human heart tissue, human oesophagus tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human placenta tissue |
| Positive IF/ICC detected in | HepG2 cells |
In sample preparation, the extracellular matrix needs to be included
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 908 publications below |
| IHC | See 135 publications below |
| IF | See 53 publications below |
| IP | See 1 publications below |
Product Information
10373-2-AP targets MMP2 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig, rabbit, monkey, bovine, fish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0549 Product name: Recombinant human MMP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 461-660 aa of BC002576 Sequence: LGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC 相同性解析による交差性が予測される生物種 |
| Full Name | matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) |
| Calculated molecular weight | 72 kDa |
| Observed molecular weight | 62-72 kDa |
| GenBank accession number | BC002576 |
| Gene Symbol | MMP2 |
| Gene ID (NCBI) | 4313 |
| RRID | AB_2250823 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P08253 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
MMP2, also named as CLG4A, Gelatinase Am, TBE-1 and PEX, belongs to the peptidase M10A family. It is ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. MMP2 contributes to myocardial oxidative stress by regulating the activity of GSK3beta. It cleaves GSK3beta in vitro. MMP2 can be cleaved into PEX chain(~60kd). Western blot analysis showed that the 72 kDa and 62/65 kDa proteinase activities were pro-MMP2 and the active enzyme, respectively (PMID:11112697,PMID: 30867536).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MMP2 antibody 10373-2-AP | Download protocol |
| IHC protocol for MMP2 antibody 10373-2-AP | Download protocol |
| IP protocol for MMP2 antibody 10373-2-AP | Download protocol |
| WB protocol for MMP2 antibody 10373-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Thromb Haemost Pharmacological reduction of coagulation factor XI reduces macrophage accumulation and accelerates deep vein thrombosis resolution in a mouse model of venous thrombosis. | ||
Cell Host Microbe Gut microbiome dysbiosis contributes to abdominal aortic aneurysm by promoting neutrophil extracellular trap formation | ||
Circ Res Unspliced XBP1 Confers VSMC Homeostasis and Prevents Aortic Aneurysm Formation via FoxO4 Interaction. | ||
J Thorac Oncol Silencing NKD2 by Promoter Region Hypermethylation Promotes Esophageal Cancer Progression by Activating Wnt Signaling. | ||
Small M2 Macrophage Membrane-Mediated Biomimetic-Nanoparticle Carrying COX-siRNA Targeted Delivery for Prevention of Tendon Adhesions by Inhibiting Inflammation | ||
Nat Commun Cytoplasmic LIF reprograms invasive mode to enhance NPC dissemination through modulating YAP1-FAK/PXN signaling. |



















