Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse brain tissue, HeLa cells, mouse kidney tissue, rat brain tissue, rat heart tissue, mouse liver tissue, rat kidney tissue, rat liver tissue |
| Positive IP detected in | mouse kidney tissue |
| Positive IHC detected in | human colon cancer tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 18 publications below |
| WB | See 443 publications below |
| IHC | See 30 publications below |
| IF | See 40 publications below |
| IP | See 8 publications below |
| CoIP | See 5 publications below |
Product Information
12186-1-AP targets MFN2 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, monkey, chicken, zebrafish, bovine, goat, duck |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2845 Product name: Recombinant human MFN2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2-353 aa of BC017061 Sequence: SLLFSRCNSIVTVKKNKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESATFLEDTYRNAELDPVTTEEQVLDVKGYLSKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAGSLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRSQAGDRIFFVSAKEVLNARIQKAQGMPEGGGALAEGFQVRMFEFQNFERRFEECISQSA 相同性解析による交差性が予測される生物種 |
| Full Name | mitofusin 2 |
| Calculated molecular weight | 757 aa, 86 kDa |
| Observed molecular weight | 86 kDa |
| GenBank accession number | BC017061 |
| Gene Symbol | MFN2 |
| Gene ID (NCBI) | 9927 |
| ENSEMBL Gene ID | ENSG00000116688 |
| RRID | AB_2266320 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95140 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
MFN2, also named as CPRP1 and KIAA0214, belongs to the mitofusin family. It is an Essential transmembrane GTPase, which mediates mitochondrial fusion. MFN2 acts independently of the cytoskeleton. It therefore plays a central role in mitochondrial metabolism and may be associated with obesity and/or apoptosis processes. Overexpression of MFN2 induces the formation of mitochondrial networks. It plays an important role in the regulation of vascular smooth muscle cell proliferation. Defects in MFN2 are the cause of Charcot-Marie-Tooth disease type 2A2 (CMT2A2). Defects in MFN2 are the cause of Charcot-Marie-Tooth disease type 6 (CMT6). Ubiquitinated forms of Mfn2 (mono- and polyubiquitinated) are present during mitophagy.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MFN2 antibody 12186-1-AP | Download protocol |
| IP protocol for MFN2 antibody 12186-1-AP | Download protocol |
| WB protocol for MFN2 antibody 12186-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nature Cellular ATP demand creates metabolically distinct subpopulations of mitochondria
| ||
Cell Mitocytosis, a migrasome-mediated mitochondrial quality-control process.
| ||
Cell Metab Mitochondrial Dynamics Is Critical for the Full Pluripotency and Embryonic Developmental Potential of Pluripotent Stem Cells. | ||
ACS Cent Sci Macrophage Inactivation by Small Molecule Wedelolactone via Targeting sEH for the Treatment of LPS-Induced Acute Lung Injury | ||
Nat Commun Engineered hypoxia-responsive albumin nanoparticles mediating mitophagy regulation for cancer therapy | ||
Mol Cell Serine synthesis sustains macrophage IL-1β production via NAD+-dependent protein acetylation |







