Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse brain tissue, HeLa cells, SH-SY5Y cells, mouse kidney tissue, rat brain tissue | 
| Positive IP detected in | mouse brain tissue | 
| Positive IHC detected in | rat testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 4 publications below | 
| WB | See 10 publications below | 
| IHC | See 1 publications below | 
| IP | See 2 publications below | 
Product Information
21552-1-AP targets MARK1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse, rat | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | CatNo: Ag16225 Product name: Recombinant human MARK1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 506-611 aa of BC113869 Sequence: VCERTTDRYVALQNGKDSSLTEMSVSSISSAGSSVASAVPSARPRHQKSMSTSGHPIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPDRTRFPRGSSSR相同性解析による交差性が予測される生物種 | 
| Full Name | MAP/microtubule affinity-regulating kinase 1 | 
| Calculated molecular weight | 795 aa, 89 kDa | 
| Observed molecular weight | 85-89 kDa, 72 kDa | 
| GenBank accession number | BC113869 | 
| Gene Symbol | MARK1 | 
| Gene ID (NCBI) | 4139 | 
| RRID | AB_10732726 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q9P0L2 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
MARK1, also named as MAP-microtubule affinity regulating kinase 1, which form a subfamily of the calcium/calmodulin-dependent protein kinase (CAMP) group of kinases(PMID: 22670221). It is involved in cell polarity by phosphorylating the microtubule-associated proteins MAP2, MAP4 and MAPT/TAU at KXGS motifs, causing detachment from microtubules, and their disassembly. MARK1 also act as a regulator of the neuronal migration and Wnt signaling pathway. It has 3 isoforms which molecular weight is 89,84,72 kDa. This antibody may detect all of the isoforms.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MARK1 antibody 21552-1-AP | Download protocol | 
| IP protocol for MARK1 antibody 21552-1-AP | Download protocol | 
| WB protocol for MARK1 antibody 21552-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
| Mol Cell An AMPK-Independent Signaling Pathway Downstream of the LKB1 Tumor Suppressor Controls Snail1 and Metastatic Potential.
 | ||
| Nat Commun TNK1 is a ubiquitin-binding and 14-3-3-regulated kinase that can be targeted to block tumor growth.
 | ||
| Cell Rep DIXDC1 Phosphorylation and Control of Dendritic Morphology Are Impaired by Rare Genetic Variants. | ||
| J Neurosci Unbiased proteomics of early Lewy body formation model implicates active microtubule affinity-regulating kinases (MARKs) in synucleinopathies. | ||
| Cell Commun Signal Doublecortin undergo nucleocytoplasmic transport via the RanGTPase signaling to promote glioma progression. | ||
| J Biol Chem Postsynaptic density 95 (PSD-95) serine 561 phosphorylation regulates a conformational switch and bidirectional dendritic spine structural plasticity. | 









