Validation Data Gallery
Tested Applications
| Positive WB detected in | A431 cells, human lung tissue, mouse spleen tissue, mouse brain tissue, rat brain tissue, A549 cells, mouse lung tissue, rat lung tissue | 
| Positive IP detected in | mouse brain tissue | 
| Positive IHC detected in | human breast cancer tissue, mouse spleen tissue,  mouse lung tissue,  human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 | 
| Positive IF/ICC detected in | A431 cells, HeLa cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 9 publications below | 
| WB | See 27 publications below | 
| IHC | See 17 publications below | 
| IF | See 9 publications below | 
Product Information
16112-1-AP targets LPCAT1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse, rat | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | CatNo: Ag9035 Product name: Recombinant human LPCAT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 51-395 aa of BC020166 Sequence: IKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGAPVQPVVLRYPNKLDTITWTWQGPGALEILWLTLCQFHNQVEIEFLPVYSPSEEEKRNPALYASNVRRVMAEALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSVVCRPARTLDTIQLAFKMYGAQEDGSVGEGDLSCILKTALGVAELTVTDLFRAIDQEEKGKITFADFHRFAEMYPAFAEEYLYPDQTHFESCAETSPAPIPNGFCADFSPENSDAGRKPVRKKLD相同性解析による交差性が予測される生物種 | 
| Full Name | lysophosphatidylcholine acyltransferase 1 | 
| Calculated molecular weight | 534 aa, 59 kDa | 
| Observed molecular weight | 59 kDa | 
| GenBank accession number | BC020166 | 
| Gene Symbol | LPCAT1 | 
| Gene ID (NCBI) | 79888 | 
| RRID | AB_2135554 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q8NF37 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
LPCAT1, also named as AYTL2, PFAAP3 and LysoPAFAT, belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family. It is a key enzyme for remodeling phospholipids, including phosphatidylcholine. The expression level of LPCAT1 is able to differentiate prostate cancer from noncancerous prostatic changes, and correlates to the tumor grade of prostate cancer. LPCAT1 possesses both acyltransferase and acetyltransferase activities. It mediates the conversion of 1-acyl-sn-glycero-3-phosphocholine (LPC) into phosphatidylcholine (PC).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for LPCAT1 antibody 16112-1-AP | Download protocol | 
| IHC protocol for LPCAT1 antibody 16112-1-AP | Download protocol | 
| IP protocol for LPCAT1 antibody 16112-1-AP | Download protocol | 
| WB protocol for LPCAT1 antibody 16112-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
| Cell Metab Oncogene Amplification in Growth Factor Signaling Pathways Renders Cancers Dependent on Membrane Lipid Remodeling.
 | ||
| J Hepatol Lysophosphatidylcholine acyltransferase 1 altered phospholipid composition and regulated hepatoma progression.
 | ||
| Proc Natl Acad Sci U S A Regulation of stem cell function and neuronal differentiation by HERV-K via mTOR pathway.
 | ||
| Elife Human embryonic lung epithelial tips are multipotent progenitors that can be expanded in vitro as long-term self-renewing organoids. | ||
| Front Immunol Identification of molecular subtypes based on PANoptosis-related genes and construction of a signature for predicting the prognosis and response to immunotherapy response in hepatocellular carcinoma
 | 


















