Validation Data Gallery
Tested Applications
| Positive WB detected in | HepG2 cells, HeLa cells, L02 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human colon cancer tissue, human brain tissue, human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 14 publications below |
| WB | See 130 publications below |
| IHC | See 7 publications below |
| IF | See 17 publications below |
| IP | See 5 publications below |
Product Information
10785-1-AP targets LDLR in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, pig, chicken, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1236 Product name: Recombinant human LDLR protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC014514 Sequence: MGPWGWKLRWTVALLLAAAGTAVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQR 相同性解析による交差性が予測される生物種 |
| Full Name | low density lipoprotein receptor |
| Calculated molecular weight | 95 kDa |
| Observed molecular weight | 100-160 kDa |
| GenBank accession number | BC014514 |
| Gene Symbol | LDLR |
| Gene ID (NCBI) | 3949 |
| ENSEMBL Gene ID | ENSG00000130164 |
| RRID | AB_2281164 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01130 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
LDLR (low density lipoprotein receptor) is a member of the LDL receptor gene family and is involved in receptor-mediated endocytosis of specific ligands. The LDLR is a cell surface glycoprotein that scavenges LDL from the blood and regulates plasma LDL cholesterol. The cytoplasmic domain of the LDL receptor is necessary for the receptor to cluster in coated pits, which promotes the rapid endocytosis of bound LDL. The protein is highly glycosylated through N- and O-linkages and thus migrates at 100 to 160 kDa bands on SDS-PAGE.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for LDLR antibody 10785-1-AP | Download protocol |
| IHC protocol for LDLR antibody 10785-1-AP | Download protocol |
| IP protocol for LDLR antibody 10785-1-AP | Download protocol |
| WB protocol for LDLR antibody 10785-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Metab Elevation of JAML Promotes Diabetic Kidney Disease by Modulating Podocyte Lipid Metabolism. | ||
Cell Metab Identification and evaluation of a lipid-lowering small compound in preclinical models and in a Phase I trial. | ||
Sci Transl Med Single-cell atlas of human infrapatellar fat pad and synovium implicates APOE signaling in osteoarthritis pathology | ||
Acta Pharm Sin B Design, synthesis, and biological evaluation of novel tetrahydroprotoberberine derivatives (THPBs) as proprotein convertase subtilisin/kexin type 9 (PCSK9) modulators for the treatment of hyperlipidemia. | ||
J Clin Invest Acetaldehyde dehydrogenase 2 interactions with LDLR and AMPK regulate foam cell formation.
|









