Validation Data Gallery
Tested Applications
| Positive WB detected in | A431 cells, HT-1080 cells, HT-29 cells | 
| Positive IHC detected in | human tonsillitis tissue, human brown disease,  human oesophagus cancer tissue,  human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 | 
| Positive IF/ICC detected in | A431 cells | 
| Positive FC (Intra) detected in | A431 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 | 
| Immunohistochemistry (IHC) | IHC : 1:200-1:1000 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 | 
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 8 publications below | 
| IHC | See 2 publications below | 
| IF | See 4 publications below | 
Product Information
28462-1-AP targets Involucrin in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human | 
| Cited Reactivity | human, mouse | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | CatNo: Ag29585 Product name: Recombinant human Involucrin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 234-361 aa of NM_005547 Sequence: EVPSKQEGQLELSEQQEGQLELSEQQEGQLKHLEHQEGQLEVPEEQMGQLKYLEQQEGQLKHLDQQEKQPELPEQQMGQLKHLEQQEGQPKHLEQQEGQLEQLEEQEGQLKHLEQQEGQLEHLEHQEG相同性解析による交差性が予測される生物種 | 
| Full Name | involucrin | 
| Calculated molecular weight | 68 kDa | 
| Observed molecular weight | 120 kDa | 
| GenBank accession number | NM_005547 | 
| Gene Symbol | Involucrin | 
| Gene ID (NCBI) | 3713 | 
| RRID | AB_2881148 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | P07476 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
Involucrin is a protein precursor of the epidermal cornified envelope that is assembled in the outermost layers of the epidermis. Involucrin expression is restricted to the suprabasal epidermal layers (spinous and granular layers) during normal keratinocyte differentiation and is a useful marker of terminal differentiation. The predicted MW of involucrin is 68 kDa, but it also forms 120 kDa dimers, while different reports provided variable results ranging from 90-140 kDa. (PMID: 11099111, 1503502, 12150517)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Involucrin antibody 28462-1-AP | Download protocol | 
| IHC protocol for Involucrin antibody 28462-1-AP | Download protocol | 
| WB protocol for Involucrin antibody 28462-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
| J Nanobiotechnology Exosomes from human induced pluripotent stem cells-derived keratinocytes accelerate burn wound healing through miR-762 mediated promotion of keratinocytes and endothelial cells migration. | ||
| Int Immunopharmacol Nicotinamide mononucleotide ameliorates DNFB-induced atopic dermatitis-like symptoms in mice by blocking activation of ROS-mediated JAK2/STAT5 signaling pathway. | ||
| J Ethnopharmacol Protective effect of oligosaccharides isolated from Panax ginseng C. A. Meyer against UVB-induced skin barrier damage in BALB/c hairless mice and human keratinocytes. | ||
| Int J Chron Obstruct Pulmon Dis High BMP7 Expression May Worsen Airway Disease in COPD by Altering Epithelial Cell Behavior | ||
| J Oncol Downregulation of S100A9 Reverses Cisplatin-Resistance and Inhibits Proliferation and Migration in Hypopharyngeal Carcinoma | ||
| Biol Pharm Bull Pyridoxine Has a Potential to Prevent the Appearance of Pigmented Spots: Effects on the Phagocytosis and Differentiation of Keratinocytes | 
















