Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, A549 cells, mouse skeletal muscle tissue, mouse liver tissue, mouse brain tissue, Hela cells, HepG cells, MCF-7 cells, NIH/3T3 cells, mouse kidney tissue, rat kidney tissue |
| Positive IP detected in | MCF-7 cells |
| Positive IHC detected in | human oesophagus cancer tissue, human skin cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:600-1:2400 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 1073 publications below |
| IHC | See 4 publications below |
| IF | See 13 publications below |
| IP | See 1 publications below |
| CoIP | See 2 publications below |
| ChIP | See 11 publications below |
Product Information
17168-1-AP targets Histone H3 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey, chicken, zebrafish, goat, fish, arabidopsis, yellow catfish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10644 Product name: Recombinant human Histone-H3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-136 aa of BC015544 Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 相同性解析による交差性が予測される生物種 |
| Full Name | histone cluster 2, H3a |
| Calculated molecular weight | 136 aa, 15 kDa |
| Observed molecular weight | 15-17 kDa |
| GenBank accession number | BC015544 |
| Gene Symbol | Histone H3 |
| Gene ID (NCBI) | 333932 |
| RRID | AB_2716755 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q71DI3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Histone-H3, histone cluster 2, H3a is the core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machinery which requires DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Histone-H3 is expressed during S phase; then expression strongly decreases as cell division slows down during the process of differentiation.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Histone H3 antibody 17168-1-AP | Download protocol |
| IF protocol for Histone H3 antibody 17168-1-AP | Download protocol |
| IHC protocol for Histone H3 antibody 17168-1-AP | Download protocol |
| IP protocol for Histone H3 antibody 17168-1-AP | Download protocol |
| WB protocol for Histone H3 antibody 17168-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther TRAF3 activates STING-mediated suppression of EV-A71 and target of viral evasion | ||
Mol Cancer Cell surface CD55 traffics to the nucleus leading to cisplatin resistance and stemness by inducing PRC2 and H3K27 trimethylation on chromatin in ovarian cancer | ||
Cell Targeting Epigenetic Crosstalk as a Therapeutic Strategy for EZH2-Aberrant Solid Tumors. |
















