Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse brain tissue, human heart tissue, human brain tissue, PC-12 cells, mouse heart tissue, rat brain tissue, SH-SY5Y cells, U-87 MG cells | 
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF-P detected in | mouse brain tissue | 
| Positive FC (Intra) detected in | U-87 MG cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 | 
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below | 
| WB | See 9 publications below | 
| IHC | See 4 publications below | 
| IF | See 6 publications below | 
Product Information
10690-1-AP targets GMF Beta in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse, rat, zebrafish | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag1104 Product name: Recombinant human GMFB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-154 aa of BC005359 Sequence: MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFTNVNFCVSKVFMY 相同性解析による交差性が予測される生物種 | 
                                    
| Full Name | glia maturation factor, beta | 
| Calculated molecular weight | 17 kDa | 
| Observed molecular weight | 17 kDa | 
| GenBank accession number | BC005359 | 
| Gene Symbol | GMFB | 
| Gene ID (NCBI) | 2764 | 
| RRID | AB_2110837 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | P60983 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
GMFB, Glia maturation factor beta, is a nerve growth factor implicated in nervous system development. It was reported that GMF-beta promotes the phenotypic expression of glia and neurons and inhibits the proliferation of their respective tumors in culture cells. GMF-beta protein is specific to the brain where it is expressed in glial cells (mainly astrocytes) and insome neurons. Higher levels of GMFB were found in the central nervous system, except for the spinal cord, and in thymus and colon. GMFB was positive in the cytoplasm and nuclei of all cells in whole brain.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for GMF Beta antibody 10690-1-AP | Download protocol | 
| IHC protocol for GMF Beta antibody 10690-1-AP | Download protocol | 
| WB protocol for GMF Beta antibody 10690-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Int J Biol Macromol SUMOylation of GMFB regulates its stability and function in retinal pigment epithelial cells under hyperglycemia | ||
Development Coronary veins determine the pattern of sympathetic innervation in the developing heart. | ||
Int J Mol Sci Parkinson's Disease Dementia Patients: Expression of Glia Maturation Factor in the Brain | ||
Eur J Cancer Identification of glia maturation factor beta as an independent prognostic predictor for serous ovarian cancer. | ||
Front Oncol Glia Maturation Factor Beta as a Novel Biomarker and Therapeutic Target for Hepatocellular Carcinoma. | ||
Front Oncol Glia Maturation Factor β as a Novel Independent Prognostic Biomarker and Potential Therapeutic Target of Kidney Renal Clear Cell Carcinoma. | 








