Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse stomach tissue, mouse ovary tissue, HeLa cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse placenta tissue, human ovary tumor tissue, human cervix tissue, human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human placenta tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 4 publications below |
| IHC | See 8 publications below |
| IF | See 4 publications below |
Product Information
12880-1-AP targets GJB3 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey, marmoset |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3839 Product name: Recombinant human GJB3 protein Source: e coli.-derived, T-HIS Tag: 6*His Domain: 101-270 aa of BC012918 Sequence: RERRHRQKHGDQCAKLYDNAGKKHGGLWWTYLFSLIFKLIIEFLFLYLLHTLWHGFNMPRLVQCANVAPCPNIVDCYIARPTEKKIFTYFMVGASAVCIVLTICELCYLICHRVLRGLHKDKPRGGCSPSSSASRASTCRCHHKLVEAGEVDPDPGNNKLQASAPNLTPI 相同性解析による交差性が予測される生物種 |
| Full Name | gap junction protein, beta 3, 31kDa |
| Calculated molecular weight | 270 aa, 31 kDa |
| Observed molecular weight | 31 kDa |
| GenBank accession number | BC012918 |
| Gene Symbol | GJB3 |
| Gene ID (NCBI) | 2707 |
| RRID | AB_2110907 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75712 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
GJB3, also known as Connexin-31 (Cx31), belongs to the connexin family. Connexins are membrane-spanning proteins that assemble to form gap junction channels that facilitate the transfer of ions and small molecules between cells. Mutations in the gene of GJB3 have been described in patients with dominant and recessive hearing impairment and in patients with erythrokeratodermia variabilis (EKV).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for GJB3 antibody 12880-1-AP | Download protocol |
| IHC protocol for GJB3 antibody 12880-1-AP | Download protocol |
| IP protocol for GJB3 antibody 12880-1-AP | Download protocol |
| WB protocol for GJB3 antibody 12880-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cancer Lett Liver metastasis or peritoneal metastasis: single-cell RNA sequencing reveals the organotropism in colorectal cancer is driven by distinct partial-EMT processes | ||
Cell Rep Cochlear Cell Modeling Using Disease-Specific iPSCs Unveils a Degenerative Phenotype and Suggests Treatments for Congenital Progressive Hearing Loss. | ||
Stem Cells FBXL12-Mediated Degradation of ALDH3 Is Essential for Trophoblast Differentiation during Placental Development. | ||
J Neurosci Glial-Specific Deletion of Med12 Results in Rapid Hearing Loss via Degradation of the Stria Vascularis. | ||
Sci Rep Distinct Expression Patterns Of Causative Genes Responsible For Hereditary Progressive Hearing Loss In Non-Human Primate Cochlea. | ||
Placenta In vitro fertilization causes excessive glycogen accumulation in mouse placenta. |














