Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse brain tissue, rat lung tissue, SH-SY5Y cells, rat brain tissue, Neuro-2a cells |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Positive IF/ICC detected in | SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 53 publications below |
| IHC | See 14 publications below |
| IF | See 26 publications below |
| IP | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
16971-1-AP targets GAP43 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, canine, zebrafish, hamster, gekko japonicus |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9294 Product name: Recombinant human GAP43 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-238 aa of BC007936 Sequence: MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA 相同性解析による交差性が予測される生物種 |
| Full Name | growth associated protein 43 |
| Calculated molecular weight | 238 aa, 25 kDa |
| Observed molecular weight | 43 kDa |
| GenBank accession number | BC007936 |
| Gene Symbol | GAP43 |
| Gene ID (NCBI) | 2596 |
| RRID | AB_2278881 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P17677 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
The neuronal growth-associated protein GAP43 is known as neuromodulin, B-50, P-57, F1, and pp46. Deficiency of GAP43 in mice results in death early in the postnatal period. GAP43 is one of the main substrates for protein kinase C in the brain. GAP43 is an intracellular growth-associated protein that appears to assist neuronal pathfinding and branching during development and regeneration and may contribute to presynaptic membrane changes in the adult, leading to neurotransmitter release, endocytosis, and synaptic vesicle recycling, long-term potentiation, spatial memory formation, and learning. The predicted molecular weight of about 25 kDa is much lower than the apparent observed molecular weight of 43 kDa on SDS-PAGE gels, and this occurs because the highly charged nature of GAP43 causes it to bind less than the average amount of SDS per amino acid, and because the protein has an elongated structure.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for GAP43 antibody 16971-1-AP | Download protocol |
| IHC protocol for GAP43 antibody 16971-1-AP | Download protocol |
| IP protocol for GAP43 antibody 16971-1-AP | Download protocol |
| WB protocol for GAP43 antibody 16971-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) An Important Function of Petrosiol E in Inducing the Differentiation of Neuronal Progenitors and in Protecting Them against Oxidative Stress. | ||
Biofabrication Pulsed electromagnetic field-assisted reduced graphene oxide composite 3D printed nerve scaffold promotes sciatic nerve regeneration in rats | ||
Mater Today Bio Ropivacaine microsphere-loaded electroconductive nerve dressings for long-acting analgesia and functional recovery following diabetic peripheral nerve injury | ||
Phytomedicine Ginsenoside Rb1 protects hippocampal neurons in depressed rats based on mitophagy-regulated astrocytic pyroptosis | ||
Environ Pollut Combined exposure of lead and high-fat diet enhanced cognitive decline via interacting with CREB-BDNF signaling in male rats. | ||
Aging (Albany NY) Enriched environment remedies cognitive dysfunctions and synaptic plasticity through NMDAR-Ca2+-Activin A circuit in chronic cerebral hypoperfusion rats. |








