Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, SGC-7901 cells, hTERT-RPE1 cells |
| Positive IHC detected in | human skin tissue, human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 49 publications below |
| WB | See 129 publications below |
| IHC | See 49 publications below |
| IF | See 100 publications below |
| CoIP | See 6 publications below |
Product Information
15939-1-AP targets Piezo1 (extracellular domain) in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, pig, canine, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7791 Product name: Recombinant human FAM38A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 67-373 aa of BC008073 Sequence: SVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIIPFTAQAYEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQRDLAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQSVVIPNLFPKYIRAPNGPEANPVKQLQPNEEADYLGVRIQLRREQGAGATGFLEWWVIELQECRTDCNLLPMVIFSDKHHGAVRVHRAGHRQVRARILQRDLALHYVRGAAVRGPHPQALPGHLPGAGDSGAGAGGGVVCQAHLPLPLTGDHDQVDS 相同性解析による交差性が予測される生物種 |
| Full Name | family with sequence similarity 38, member A |
| Calculated molecular weight | 286 kDa |
| Observed molecular weight | 233-286 kDa |
| GenBank accession number | BC008073 |
| Gene Symbol | Piezo1/FAM38A |
| Gene ID (NCBI) | 9780 |
| RRID | AB_2231460 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92508 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Mechanotransduction, the conversion of mechanical force into biological signals, is a fundamental physiologic process of mammalian cells that influences many critical processes including embryonic development, tactile, pain, and auditory sensation, regulation of vascular tone, flow sensing in the kidney, and muscle and tendon stretch. FAM38A, also known as Piezo1, has recently been identified as a mechanotransduction protein that gets involved in mechanosensation and stretch-activated cation channel activation. Piezo1 also plays a key role in epithelial cell adhesion by maintaining integrin activation through R-Ras recruitment to the ER. Mutations in the gene encoding Piezo1 are associated with hereditary xerocytosis. Piezo1 also regulates extrusion to maintain homeostatic epithelial cell numbers. This antibody was raised against the extracellular domain of human Piezo1. (PMID: 20016066, 28416610)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Piezo1 (extracellular domain) antibody 15939-1-AP | Download protocol |
| IHC protocol for Piezo1 (extracellular domain) antibody 15939-1-AP | Download protocol |
| WB protocol for Piezo1 (extracellular domain) antibody 15939-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nature Skin cells undergo asynthetic fission to expand body surfaces in zebrafish.
| ||
Nature Crowding induces live cell extrusion to maintain homeostatic cell numbers in epithelia.
| ||
Nature Mechanical stretch triggers rapid epithelial cell division through Piezo1.
| ||
Blood Mechanosensation by endothelial PIEZO1 is required for leukocyte diapedesis.
|










