Validation Data Gallery
Tested Applications
| Positive WB detected in | Jurkat cells, mouse thymus tissue, Raji cells | 
| Positive IHC detected in | rat spleen tissue, mouse spleen tissue,  rat lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 | 
| Positive IF/ICC detected in | A431 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 | 
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 5 publications below | 
| WB | See 17 publications below | 
| IF | See 2 publications below | 
| ChIP | See 1 publications below | 
Product Information
12118-1-AP targets ETS1 in WB, IHC, IF/ICC, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse, rat, sheep | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | CatNo: Ag2127 Product name: Recombinant human ETS1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-272 aa of BC017314 Sequence: MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCGQEMGKEEKQT相同性解析による交差性が予測される生物種 | 
| Full Name | v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) | 
| Calculated molecular weight | 441 aa, 50 kDa | 
| Observed molecular weight | 50 kDa | 
| GenBank accession number | BC017314 | 
| Gene Symbol | ETS1 | 
| Gene ID (NCBI) | 2113 | 
| RRID | AB_10664925 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | P14921 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
ETS1 is a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. ETS1 is a nuclear protein and primarily acts as a transcriptional activator, though it can also repress gene transcription. Since it is primarily expressed in lymphocytes, it plays several critical roles in immunity. In addition, it is important for angiogenesis. Since cells express several Ets proteins at the same time, functional redundancy is possible. This is particularly shown for the socalled housekeeping genes where several Ets factors were found to occupy the proximal promoters in vivo. The ETS1 protein exists as three isoforms: ETS1-p51, ETS1-p42, ETS1-p27 ranging in size from 27 to 51 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ETS1 antibody 12118-1-AP | Download protocol | 
| IHC protocol for ETS1 antibody 12118-1-AP | Download protocol | 
| WB protocol for ETS1 antibody 12118-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
| Cell Stem Cell PSPC1 exerts an oncogenic role in AML by regulating a leukemic transcription program in cooperation with PU.1 | ||
| Nat Commun HIV reprograms host m 6 Am RNA methylome by viral Vpr protein-mediated degradation of PCIF1 | ||
| Front Cell Dev Biol rSjP40 Inhibited the Activity of Collagen Type I Promoter via Ets-1 in HSCs.
 | ||
| Oncotarget DOT1L promotes angiogenesis through cooperative regulation of VEGFR2 with ETS-1. | ||
| Lung ETS1 Ameliorates Hyperoxia-Induced Bronchopulmonary Dysplasia in Mice by Activating Nrf2/HO-1 Mediated Ferroptosis | ||
| Int J Biol Sci The RNF26/CBX7 axis modulates the TNF pathway to promote cell proliferation and regulate sensitivity to TKIs in ccRCC. | 











