Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse brain tissue, human placenta tissue, mouse kidney tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human liver cancer tissue, human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 10 publications below |
| IHC | See 4 publications below |
Product Information
14243-1-AP targets ENPP2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5499 Product name: Recombinant human ENPP2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 30-383 aa of BC034961 Sequence: AHRIKRAEGWEEGPPTVLSDSPWTNISGSCKGRCFELQEAGPPDCRCDNLCKSYTSCCHDFDELCLKTARGWECTKDRCGEVRNEENACHCSEDCLARGDCCTNYQVVCKGESHWVDDDCEEIKAAECPAGFVRPPLIIFSVDGFRASYMKKGSKVMPNIEKLRSCGTHSPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITATKQGVKAGTFFWSVVIPHERRILTILQWLTLPDHERPSVYAFYSEQPDFSGHKYGPFGPEMTNPLREIDKIVGQLMDGLKQLKLHRCVNVIFVGDHGMEDVTCDRTEFLSNYLTNVDDI 相同性解析による交差性が予測される生物種 |
| Full Name | ectonucleotide pyrophosphatase/phosphodiesterase 2 |
| Calculated molecular weight | 99 kDa |
| Observed molecular weight | 100-110 kDa |
| GenBank accession number | BC034961 |
| Gene Symbol | ENPP2 |
| Gene ID (NCBI) | 5168 |
| RRID | AB_2878033 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13822 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
ENPP2, Autotaxin or Extracellular lysophospholipase D, is a 863 amino acid secreted protein, which is detected in blood plasma (at protein level) (PubMed:12176993, PubMed:26371182). ENPP2 is Predominantly expressed in brain, placenta, ovary, and small intestine. ENPP2 is expressed in a number of carcinomas such as hepatocellular and prostate carcinoma, neuroblastoma and non-small-cell lung cancer. ENPP2 is expressed in body fluids such as plasma, cerebral spinal fluid (CSF), saliva, follicular and amniotic fluids. The calculated molecular weight of ENPP2 is about 100 kDa (PMID: 22301782), but modified ENPP2 is 120 kDa (PMID: 19808661). ENPP2 Hydrolyzes lysophospholipids to produce the signaling molecule lysophosphatidic acid (LPA) in extracellular fluids (PubMed:15769751, PubMed:26371182, PubMed:27754931).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ENPP2 antibody 14243-1-AP | Download protocol |
| IP protocol for ENPP2 antibody 14243-1-AP | Download protocol |
| WB protocol for ENPP2 antibody 14243-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Cardiovasc Res Excessive HIF-1α driven by phospholipid metabolism causes septic cardiomyopathy through cytopathic hypoxia | ||
Mol Psychiatry Transthyretin, a novel prognostic marker of POCD revealed by time-series RNA-sequencing analysis | ||
Thyroid Increased thyroid hormone action alleviates hippocampal damage by down-regulating neuronal type-Ⅰ interferon signaling/necroptosis in diabetes-associated cognitive dysfunction | ||
Cells Role of Aberrantly Activated Lysophosphatidic Acid Receptor 1 Signaling Mediated Inflammation in Renal Aging. | ||
Front Pharmacol The mechanism of Renshen-Fuzi herb pair for treating heart failure—Integrating a cardiovascular pharmacological assessment with serum metabolomics | ||
Am J Physiol Cell Physiol The Ecto-Nucleotide Pyrophosphatase/Phosphodiesterase 2 Promotes Early Osteoblast Differentiation and Mineralization in Stromal Stem Cells |