Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse uterus tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human colon tissue, human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:600-1:2400 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 23 publications below |
| IHC | See 1 publications below |
| IF | See 7 publications below |
| IP | See 1 publications below |
Product Information
12831-1-AP targets Alpha E-Catenin in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3565 Product name: Recombinant human CTNNA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 188-536 aa of BC031262 Sequence: SEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSSDPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVASTKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEFKAMDSI 相同性解析による交差性が予測される生物種 |
| Full Name | catenin (cadherin-associated protein), alpha 1, 102kDa |
| Calculated molecular weight | 906 aa, 100 kDa |
| Observed molecular weight | 100 kDa |
| GenBank accession number | BC031262 |
| Gene Symbol | Alpha E-Catenin |
| Gene ID (NCBI) | 1495 |
| RRID | AB_2087822 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P35221 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Alpha catenin is an essential component of adherens junctions that connects E-cadherin-β-catenin complexes with the actin cytoskeleton. It also recruits a range of other important proteins to developing intercellular junctions. Three alpha catenins exist in human: alpha-E-catenin, alpha-N-catenin, and alpha-T-catenin, which share substantial amino-acid sequence similarity but have distinct tissue distribution. alpha-E-catenin is ubiquitously expressed, alpha-N-catenin is restricted to neuronal tissue, and alpha-T-catenin is primarily expressed in heart tissue. Reduced levels of alpha-E-catenin protein seem to be characteristic of many different human cancers, including malignant tumours of the breast, colon, stomach, oesophagus, bladder and liver. In addition, the loss of alpha-E-catenin often correlates with the degree of tumour differentiation and metastasis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Alpha E-Catenin antibody 12831-1-AP | Download protocol |
| IHC protocol for Alpha E-Catenin antibody 12831-1-AP | Download protocol |
| IP protocol for Alpha E-Catenin antibody 12831-1-AP | Download protocol |
| WB protocol for Alpha E-Catenin antibody 12831-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Oncogene Transducin (β)-like 1 X-linked receptor 1 promotes gastric cancer progression via the ERK1/2 pathway. | ||
Elife Selective YAP activation in Procr cells is essential for ovarian stem/progenitor expansion and epithelium repair. | ||
Oncogene The reciprocal interaction between tumor cells and activated fibroblasts mediated by TNF-α/IL-33/ST2L signaling promotes gastric cancer metastasis. | ||
Helicobacter Helicobacter pylori Dwelling on the Apical Surface of Gastrointestinal Epithelium Damages the Mucosal Barrier Through Direct Contact. | ||
Cells P-Cadherin Regulates Intestinal Epithelial Cell Migration and Mucosal Repair, but Is Dispensable for Colitis Associated Colon Cancer. | ||
Sci Rep SPOCK1 is a novel inducer of epithelial to mesenchymal transition in drug-induced gingival overgrowth. |








