Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse skeletal muscle tissue, mouse heart tissue, rat heart tissue, rat skeletal muscle tissue |
| Positive IP detected in | mouse heart tissue, mouse skeletal muscle tissue |
| Positive IHC detected in | mouse heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse heart tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:20000-1:100000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 5 publications below |
| WB | See 84 publications below |
| IHC | See 3 publications below |
| IF | See 4 publications below |
| IP | See 1 publications below |
Product Information
22170-1-AP targets CPT1B-specific in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, zebrafish, sheep, ewes |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17840 Product name: Recombinant human CPT1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 110-250 aa of BC131570 Sequence: FNTTRIPGKDTDVLQHLSDSRHVAVYHKGRFFKLWLYEGARLLKPQDLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAALEAIERAAFFVALDEESYSYDPEDEASLSLYGKALLHGNCYNRWF 相同性解析による交差性が予測される生物種 |
| Full Name | carnitine palmitoyltransferase 1B (muscle) |
| Calculated molecular weight | 567 aa, 64 kDa |
| Observed molecular weight | 75-85 kDa |
| GenBank accession number | BC131570 |
| Gene Symbol | CPT1B |
| Gene ID (NCBI) | 1375 |
| RRID | AB_2713959 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92523 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Carnitine palmitoyltransferases (CPTs) mediate the transport of long chain fatty acyl groups into the mitochondrial matrix to undergo b-oxidation. Type I CPT resides in the outer mitochondrial membrane. Mammalian tissues express three isoforms: CPT1A (liver), CPT1B (muscle and heart), and CPT1C (brain). Several isoforms of CPT1B exist due to the alternative splicing, with predicted MW of 88/84/79/66 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CPT1B-specific antibody 22170-1-AP | Download protocol |
| IHC protocol for CPT1B-specific antibody 22170-1-AP | Download protocol |
| IP protocol for CPT1B-specific antibody 22170-1-AP | Download protocol |
| WB protocol for CPT1B-specific antibody 22170-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Metab A mechanosensitive lipolytic factor in the bone marrow promotes osteogenesis and lymphopoiesis. | ||
Cell Metab Global Analysis of Plasma Lipids Identifies Liver-Derived Acylcarnitines as a Fuel Source for Brown Fat Thermogenesis.
| ||
Nat Commun Moderate-intensity interval exercise exacerbates cardiac lipotoxicity in high-fat, high-calories diet-fed mice | ||
Adv Sci (Weinh) m6A-Modified circTET2 Interacting with HNRNPC Regulates Fatty Acid Oxidation to Promote the Proliferation of Chronic Lymphocytic Leukemia | ||
Nat Commun Mechanism of action and therapeutic route for a muscular dystrophy caused by a genetic defect in lipid metabolism. | ||
J Biomed Sci Adipocyte pyroptosis occurs in omental tumor microenvironment and is associated with chemoresistance of ovarian cancer |










