Validation Data Gallery
Tested Applications
| Positive WB detected in | HepG2 cells, human brain tissue, MCF-7 cells, human heart tissue, human lung tissue, A375 cells | 
| Positive IP detected in | HepG2 cells | 
| Positive IHC detected in | human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF/ICC detected in | HepG2 cells, HeLa cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below | 
| WB | See 13 publications below | 
| IHC | See 4 publications below | 
| IF | See 4 publications below | 
Product Information
11463-1-AP targets COX4I2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse, rat | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag1987 Product name: Recombinant human COX4I2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-171 aa of BC057779 Sequence: MLPRAAWSLVLRKGGGGRRGMHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSNEWKTVMGCVFFFIGFAALVIWWQRVYVFPPKPITLTDERKAQQLQRMLDMKVNPVQGLASRWDYEKKQWKK 相同性解析による交差性が予測される生物種 | 
                                    
| Full Name | cytochrome c oxidase subunit IV isoform 2 (lung) | 
| Calculated molecular weight | 171 aa, 20 kDa | 
| Observed molecular weight | 17-18 kDa | 
| GenBank accession number | BC057779 | 
| Gene Symbol | COX4I2 | 
| Gene ID (NCBI) | 84701 | 
| RRID | AB_2085287 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q96KJ9 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
COX4I2, also named as COX4L2 and COXIV-2, belongs to the cytochrome c oxidase IV family. It is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COXIV(cytochrome c oxidase IV) has two isoforms (isoform 1 and 2). Isoform 1(COX4I1) is ubiquitously expressed and isoform 2 is highly expressed in lung tissues. This antibody was generated against full length COX4I2 protein.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for COX4I2 antibody 11463-1-AP | Download protocol | 
| IHC protocol for COX4I2 antibody 11463-1-AP | Download protocol | 
| IP protocol for COX4I2 antibody 11463-1-AP | Download protocol | 
| WB protocol for COX4I2 antibody 11463-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Cell Rep Defective Mitochondrial Cardiolipin Remodeling Dampens HIF-1α Expression in Hypoxia. | ||
Oncotarget Nuclear-encoded cytochrome c oxidase subunit 4 regulates BMI1 expression and determines proliferative capacity of high-grade gliomas.
  | ||
Sci Signal Acute O2 sensing through HIF2α-dependent expression of atypical cytochrome oxidase subunits in arterial chemoreceptors.
  | ||
Free Radic Biol Med Cytochrome c oxidase mediates labile iron level and radioresistance in glioblastoma. | ||
Bioconjug Chem GnRH-Gemcitabine Conjugates for the Treatment of Androgen-Independent Prostate Cancer: Pharmacokinetic Enhancements Combined with Targeted Drug Delivery. | ||
Free Radic Biol Med Differentiation of SH-SY5Y cells to a neuronal phenotype changes cellular bioenergetics and the response to oxidative stress. | 













