Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, HL-60 cells, pig brain tissue, Raji cells, mouse brain tissue, rat brain tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human colon tissue, human breast cancer tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 8 publications below |
| IF | See 8 publications below |
| CoIP | See 1 publications below |
Product Information
26523-1-AP targets CLTC in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, pig, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25041 Product name: Recombinant human CLTC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC054489 Sequence: MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRM 相同性解析による交差性が予測される生物種 |
| Full Name | clathrin, heavy chain (Hc) |
| Calculated molecular weight | 192 kDa |
| Observed molecular weight | 180 kDa |
| GenBank accession number | BC054489 |
| Gene Symbol | CLTC |
| Gene ID (NCBI) | 1213 |
| RRID | AB_2880542 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q00610 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Clathrin is the major protein of the polyhedral coat of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. The clathrin molecule has a triskelion shape. Each clathrin triskelion is composed of three identical heavy chains (CLTC) (160-190 kDa) and three light chains of two types, LCA (CLTA) and LCB (CLTB) (30-40 kDa). The heavy chain provides the structural backbone of the clathrin lattice. (PMID: 9133677)
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CLTC antibody 26523-1-AP | Download protocol |
| IF protocol for CLTC antibody 26523-1-AP | Download protocol |
| IHC protocol for CLTC antibody 26523-1-AP | Download protocol |
| IP protocol for CLTC antibody 26523-1-AP | Download protocol |
| WB protocol for CLTC antibody 26523-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Emerg Microbes Infect CD1d facilitates African swine fever virus entry into the host cells via clathrin-mediated endocytosis | ||
Autophagy AP2M1 mediates autophagy-induced CLDN2 (claudin 2) degradation through endocytosis and interaction with LC3 and reduces intestinal epithelial tight junction permeability. | ||
Br J Pharmacol A glycine-serine-alanine-rich peptide ameliorates Alzheimer-type neurodegeneration | ||
Aging (Albany NY) The interaction protein of SORBS2 in myocardial tissue to find out the pathogenic mechanism of LVNC disease. | ||
Vet Microbiol Invasion of Mycoplasma bovis into bovine synovial cells utilizing the clathrin-dependent endocytosis pathway.
| ||
Acta Neuropathol Commun Bridging the gap: investigating the role of phosphorylation at the serine 129 site of α-synuclein in VAPB-PTPIP51 interactions |













