Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, mouse lung tissue, HeLa cells, A431 cells, mouse kidney tissue | 
| Positive IP detected in | HEK-293 cells | 
| Positive IHC detected in | mouse brain tissue, human lung tissue,  mouse testis tissue,  human skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF/ICC detected in | HepG2 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below | 
| WB | See 7 publications below | 
| IHC | See 1 publications below | 
| IF | See 3 publications below | 
Product Information
15761-1-AP targets CHMP1A in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse | 
| Cited Reactivity | human, mouse | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag8389 Product name: Recombinant human CHMP1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-196 aa of BC007527 Sequence: MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN 相同性解析による交差性が予測される生物種 | 
                                    
| Full Name | chromatin modifying protein 1A | 
| Calculated molecular weight | 196 aa, 22 kDa | 
| Observed molecular weight | 33 kDa, 25 kDa | 
| GenBank accession number | BC007527 | 
| Gene Symbol | CHMP1A | 
| Gene ID (NCBI) | 5119 | 
| RRID | AB_2229399 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q9HD42 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
Charged multivesicular body protein 1A (CHMP1A), also known as chromatin modifying protein 1A, is a member of the ESCRT-III (endosomal sorting complex required for transport III) complex which is involved in degradation of internalized transmembrane receptor proteins and formation of multivesicular bodies (MVBs) (PMID: 16730941). CHMP1A has both nuclear and cytoplasmic distributions (PMID: 11559748; 11559747). Subcellular localization of CHMP1A seems to vary depending on the cell type (PMID: 23023333). CHMP1A is required for MVBs formation and has a role in stable gene silencing within the nucleus. Besides, the tumor suppressor role of CHMP1A has also been reported (PMID: 18787405; 22261332).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CHMP1A antibody 15761-1-AP | Download protocol | 
| IHC protocol for CHMP1A antibody 15761-1-AP | Download protocol | 
| IP protocol for CHMP1A antibody 15761-1-AP | Download protocol | 
| WB protocol for CHMP1A antibody 15761-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Nat Cell Biol Endosomal membrane tension regulates ESCRT-III-dependent intra-lumenal vesicle formation. | ||
J Extracell Vesicles Accessory ESCRT-III proteins are conserved and selective regulators of Rab11a-exosome formation | ||
Nat Commun A single genetic locus controls both expression of DPEP1/CHMP1A and kidney disease development via ferroptosis.
  | ||
Nat Commun Mechanism of Ca²⁺-triggered ESCRT assembly and regulation of cell membrane repair. | ||
Cell Rep The ESCRT-III Protein CHMP1A Mediates Secretion of Sonic Hedgehog on a Distinctive Subtype of Extracellular Vesicles.
  | 














