Validation Data Gallery
Tested Applications
| Positive WB detected in | A375 cells, mouse spleen tissue, RAW 264.7 cells, rat spleen tissue |
| Positive IP detected in | mouse spleen tissue |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 5 publications below |
| WB | See 25 publications below |
| IHC | See 9 publications below |
| IF | See 8 publications below |
| IP | See 2 publications below |
| CoIP | See 1 publications below |
| ChIP | See 2 publications below |
Product Information
11650-2-AP targets CBX3 in WB, IHC, IF/ICC, IP, CoIP, chIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2251 Product name: Recombinant human CBX3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-183 aa of BC000954 Sequence: MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ 相同性解析による交差性が予測される生物種 |
| Full Name | chromobox homolog 3 (HP1 gamma homolog, Drosophila) |
| Calculated molecular weight | 21 kDa |
| Observed molecular weight | 22 kDa |
| GenBank accession number | BC000954 |
| Gene Symbol | CBX3 |
| Gene ID (NCBI) | 11335 |
| RRID | AB_2071136 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13185 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
The family of Heterochromatin protein 1 (HP1) proteins is a family of highly conserved heterochromatin-associated non-histone chromosomal proteins , which has important functions in nucleus. These functions include gene activation or repression, regulation of binding of cohesion complexes to centromere, sequestration of genes to nuclear periphery, and heterochromatin formation and propagation. Much evidence shows that HP1 proteins interact with numerous proteins including methylated histones, histone methyltransferases and so on. CBX3 is one of the paralogues of HP1 proteins
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CBX3 antibody 11650-2-AP | Download protocol |
| IHC protocol for CBX3 antibody 11650-2-AP | Download protocol |
| IP protocol for CBX3 antibody 11650-2-AP | Download protocol |
| WB protocol for CBX3 antibody 11650-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Targeting Epigenetic Crosstalk as a Therapeutic Strategy for EZH2-Aberrant Solid Tumors. | ||
Adv Sci (Weinh) Targeting CBX3 with a Dual BET/PLK1 Inhibitor Enhances the Antitumor Efficacy of CDK4/6 Inhibitors in Prostate Cancer
| ||
J Exp Med ZNF382 controls mouse neuropathic pain via silencer-based epigenetic inhibition of Cxcl13 in DRG neurons. | ||
Nat Commun The histone H3K9 methyltransferase SUV39H links SIRT1 repression to myocardial infarction. | ||
J Cell Biol Induction of alternative lengthening of telomeres-associated PML bodies by p53/p21 requires HP1 proteins.
|








