Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse brain tissue, HepG2 cells, human heart tissue, mouse liver tissue, rat brain tissue |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | mouse brain tissue, human liver tissue, human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | Chloroquine treated HeLa cells, Chloroquine treated HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 7 publications below |
| WB | See 58 publications below |
| IHC | See 9 publications below |
| IF | See 25 publications below |
| IP | See 4 publications below |
| RIP | See 1 publications below |
Product Information
11010-1-AP targets GABARAPL1 in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey, prawn |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1473 Product name: Recombinant human ATG8L protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-117 aa of BC009309 Sequence: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK 相同性解析による交差性が予測される生物種 |
| Full Name | GABA(A) receptor-associated protein like 1 |
| Calculated molecular weight | 14 kDa |
| Observed molecular weight | 16 kDa |
| GenBank accession number | BC009309 |
| Gene Symbol | GABARAPL1 |
| Gene ID (NCBI) | 23710 |
| RRID | AB_2294415 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H0R8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
GABARAPL1 (GABARAP-like protein 1), also named ATG8, GEC1, APG8L, ATG8L, and APG8-LIKE, is a member of the GABARP (GABAA receptor-associated protein) family. GABARAPL1 was initially identified as an estrogen-regulated gene, and the protein acts in receptor and vesicle transport. It's also involved in the process of autophagy, like GABARAP and GABARAPL2, and may be considered an autophagic marker. It is expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta, and skeletal muscle, and at very low levels in the thymus and small intestine. The antibody is specific to GABARAPL1, and it doesn't recognize the recombinant GABARAP and GABARAPL2.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for GABARAPL1 antibody 11010-1-AP | Download protocol |
| IHC protocol for GABARAPL1 antibody 11010-1-AP | Download protocol |
| IP protocol for GABARAPL1 antibody 11010-1-AP | Download protocol |
| WB protocol for GABARAPL1 antibody 11010-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Circulation Markers of autophagy are downregulated in failing human heart after mechanical unloading. | ||
Cell Metab FoxO3 coordinately activates protein degradation by the autophagic/lysosomal and proteasomal pathways in atrophying muscle cells. | ||
J Extracell Vesicles Secretion of pro-angiogenic extracellular vesicles during hypoxia is dependent on the autophagy-related protein GABARAPL1. | ||
Autophagy Redundancy of human ATG4 protease isoforms in autophagy and LC3/GABARAP processing revealed in cells. | ||
Autophagy The role of GABARAPL1/GEC1 in autophagic flux and mitochondrial quality control in MDA-MB-436 breast cancer cells.
|












