Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, HuH-7 cells, mouse brain tissue | 
| Positive IP detected in | HeLa cells | 
| Positive IHC detected in | human stomach cancer tissue, human thyroid cancer tissue,  mouse colon tissue,  rat colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 | 
| Positive IF/ICC detected in | MCF-7 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 8 publications below | 
| WB | See 22 publications below | 
| IHC | See 5 publications below | 
| IF | See 4 publications below | 
| IP | See 1 publications below | 
| CoIP | See 1 publications below | 
| ChIP | See 1 publications below | 
Product Information
10203-1-AP targets APEX1 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse, rat | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | CatNo: Ag0251 Product name: Recombinant human APEX1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-318 aa of BC002338 Sequence: MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL相同性解析による交差性が予測される生物種 | 
| Full Name | APEX nuclease (multifunctional DNA repair enzyme) 1 | 
| Calculated molecular weight | 36 kDa | 
| Observed molecular weight | 36 kDa | 
| GenBank accession number | BC002338 | 
| Gene Symbol | APEX1 | 
| Gene ID (NCBI) | 328 | 
| RRID | AB_2057927 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | P27695 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
APEX1, also named as APE, APE1, HAP1 and REF-1, belongs to the DNA repair enzymes AP/ExoA family. It is a multifunctional protein that plays a central role in the cellular response to oxidative stress. The two major activities of APEX1 are in DNA repair and redox regulation of transcriptional factors. APEX nuclease is a DNA repair enzyme having apurinic/apyrimidinic (AP) endonuclease, 3-prime,5-prime-exonuclease, DNA 3-prime repair diesterase, and DNA 3-prime-phosphatase activities. On the other hand, APEX1 also exerts reversible nuclear redox activity to regulate DNA binding affinity and transcriptional activity of transcriptional factors by controlling the redox status of their DNA-binding domain, such as the FOS/JUN AP-1 complex after exposure to IR. APEX1 is involved in calcium-dependent down-regulation of parathyroid hormone (PTH) expression by binding to negative calcium response elements (nCaREs). When acetylated at Lys-6 and Lys-7, APEX1 stimulates the YBX1-mediated MDR1 promoter activity, leading to drug resistance. It also acts as an endoribonuclease involved in the control of single-stranded RNA metabolism. It plays a role in regulating MYC mRNA turnover by preferentially cleaving in between UA and CA dinucleotides of the MYC coding region determinant (CRD). In association with NMD1, APEX1 plays a role in the rRNA quality control process during cell cycle progression. 10203-1-AP is a rabbit polyclonal antibody raised against full length APE1 of human origin.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for APEX1 antibody 10203-1-AP | Download protocol | 
| IHC protocol for APEX1 antibody 10203-1-AP | Download protocol | 
| IP protocol for APEX1 antibody 10203-1-AP | Download protocol | 
| WB protocol for APEX1 antibody 10203-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
| Sci Adv Deficiency in mammalian STN1 promotes colon cancer development via inhibiting DNA repair | ||
| Cell Death Dis DNA polymerase beta connects tumorigenicity with the circadian clock in liver cancer through the epigenetic demethylation of Per1 | ||
| Mol Ther miR-1293, a Candidate for miRNA-Based Cancer Therapeutics, Simultaneously Targets BRD4 and the DNA Repair Pathway.
 | ||
| Free Radic Biol Med Systematical exploration of transcription factors in cardiomyocytes against hydrogen peroxide-induced oxidative stress by Danhong injection. | ||
| Int Immunopharmacol Inhibitors of APE1 redox and ATM synergistically sensitize osteosarcoma cells to ionizing radiation by inducing ferroptosis
 | ||
| J Ethnopharmacol Integrated network pharmacology, proteomics, molecular docking, and experiments in vivo and in vitro to explore the efficacy and potential mechanism of bufalin against hepatocellular carcinoma angiogenesis | 











