Validation Data Gallery
Tested Applications
| Positive WB detected in | DU 145 cells, LNCaP cells, PC-3 cells |
| Positive IP detected in | DU 145 cells |
| Positive IHC detected in | human testis tissue, mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | PC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
| IHC | See 3 publications below |
| IF | See 19 publications below |
Product Information
14040-1-AP targets ACRV1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | mouse, rat, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5109 Product name: Recombinant human ACRV1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-265 aa of BC014588 Sequence: MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI 相同性解析による交差性が予測される生物種 |
| Full Name | acrosomal vesicle protein 1 |
| Calculated molecular weight | 28 kDa |
| Observed molecular weight | 13-36 kDa |
| GenBank accession number | BC014588 |
| Gene Symbol | ACRV1 |
| Gene ID (NCBI) | 56 |
| RRID | AB_10640426 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P26436 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
The protein ACRV1, also known as SP-10, is an acrosomal matrix protein, which is evolutionarily conserved among mammals. It is associated with the matrix of the acrosomal vesicle in developing spermatids and the acrosomal matrix and membranes of ejaculated sperm (PMID: 8288254). Human ACRV1 protein has 11 isoforms, and molecular weight ranges from 9 to 28 kDa. ACRV1 was predominantly located in round and elongated spermatids in the testis, indicating that ACRV1 may play an important role in mammalian spermatogenesis and may be a target of a contraceptive vaccine (PMID: 21488928; 8874713).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ACRV1 antibody 14040-1-AP | Download protocol |
| IHC protocol for ACRV1 antibody 14040-1-AP | Download protocol |
| IP protocol for ACRV1 antibody 14040-1-AP | Download protocol |
| WB protocol for ACRV1 antibody 14040-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun TDRD5 binds piRNA precursors and selectively enhances pachytene piRNA processing in mice. | ||
Syst Biol Reprod Med Recellularized rat testis scaffolds with embryoid bodies cells: a promising approach for tissue engineering | ||
Bioinformatics SATINN: an automated neural network-based classification of testicular sections allows for high-throughput histopathology of mouse mutants | ||
Sci China Life Sci Homozygous deleterious variants in MYCBPAP induce asthenoteratozoospermia involving abnormal acrosome biogenesis, manchette structure and sperm tail assembly in humans and mice | ||
Nat Commun piRNA loading triggers MIWI translocation from the intermitochondrial cement to chromatoid body during mouse spermatogenesis |







